DPCstruct | MC2395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 524 ± 101 aa |
| Standard deviation of domain lengths | 100.81 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.56 |
| Pfam Score | 95.24 |
| Assigned Pfam label(s) | PF16134- PF11732- PF11262 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446NZT9 | 1-307 | MELKCLFQYIVNQLKKGLGTELVVLEELIQQMANVQYTENMTDEQVDGMAGSETLRLQSSLFGSTRNYKVLNKSTNKLRDSLLPKDE… |
| A0A813C6P6 | 1-602 | MAAASANSAAPSNRTLDDKLVAIIYKHLLPAISIAKPNPFLSSVAWNVLKQLTVFQRYMIYSCWETRYSQFMLKYSYEEAKFEAKKI… |
| A0A077ZF34 | 134-694 | None |
| F4NSU7 | 589-1219 | None |
| A0A180G634 | 3-420 | None |
| B2KI97 | 451-1013 | None |
| A0A835RQ69 | 1-349 | None |
| A0A2C9JZK7 | 37-602 | None |
| A0A2G9URE6 | 2-571 | None |
| A0A1I8JQY3 | 72-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.