DPCstruct | MC23949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 275 ± 16 aa |
| Standard deviation of domain lengths | 16.25 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 67.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 43.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446PUQ7 | 31-277 | YSDSFKIELGRNDVEKISISKRTDGFLKWMWSECCDRQLTCAMKYGKKRCSALMHSCNYCYQIYLAEERHCSSCHKTFKSIYNYSEH… |
| A0A6P6W181 | 133-415 | VVNDAGIGQLNHSDQSDQNTSREDSLSAVSDVDNNLSLIEVQKDVPSGAVVFEMRKAEQQRHRWNLTQAFDRWIWKSFYSNLNAVKH… |
| A0A2P2MBV6 | 498-773 | None |
| A0A452ZWC3 | 721-1002 | None |
| A0A7N0UBZ7 | 827-1086 | None |
| A0A287KD52 | 314-628 | None |
| A0A287KD01 | 223-500 | None |
| Q9FFH1 | 1164-1422 | None |
| A0A6A6K968 | 12-277 | None |
| A0A1U8K5E0 | 670-952 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.