DPCstruct | MC23948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 263 ± 45 aa |
| Standard deviation of domain lengths | 44.77 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 18.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08584 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6XPS9 | 2-237 | LSEGRPGVDNVFSLHDGNLRLEVNKPTYERAGLQGTPLPNEGRKHIKTRFAIDVNLRQPSMVRGHKGFERILWACRNVFDHSVTWLF… |
| A0A3M7T665 | 4-285 | LFKDTFCHQVDIIVPNKERVFDKIKNLFSRYYFLSKVSLSELLSDDFIDKFYKNGDLYLYSLNTKLDCETCACLIPSGKLILNVSKS… |
| A0A3P7FW55 | 129-369 | None |
| A0A1Y1UN96 | 8-241 | None |
| A0A397UG15 | 3-220 | None |
| K8ER15 | 28-389 | None |
| A0A284R5M1 | 8-322 | None |
| A0A6G0ZLW2 | 35-279 | None |
| L1LFV1 | 47-287 | None |
| A0A5J4P3A8 | 5-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.