DPCstruct | MC23945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 119 ± 18 aa |
| Standard deviation of domain lengths | 18.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.76 |
| Pfam Score | 98.61 |
| Assigned Pfam label(s) | CL0159- CL0764 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2I336 | 4-110 | DEIPVYKTYAVILDKFIVAELTDTGGRKKIVVRSGWHGHSDLAGFLQDELDDSNIYPKIIGGGKIILDPARQSVEIYGESTSYGSEP… |
| A0A3M7T0D5 | 198-316 | LDHFAELVKPIMDNIANVDIDESGRFKYILIKVKSSENEKYVVRGYAWAEFHADILDEFEKANRDRRVAIECVGGGRILHEPEKKSI… |
| A0A812UWB1 | 35-149 | None |
| A0A482WMA4 | 9-111 | None |
| A0A7R9A2F8 | 100-224 | None |
| A0A815NU12 | 46-132 | None |
| D3BIF9 | 8-171 | None |
| A0A3M1NJE3 | 76-183 | None |
| A0A842W655 | 163-264 | None |
| A0A7J6ZSJ9 | 255-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.