DPCstruct | MC23944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 119 ± 15 aa |
| Standard deviation of domain lengths | 14.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4JVH3 | 48-198 | EILKAELEKKTVKKKVAKPATTTLLRKNKQLEKELSKDQVRRSFEKPIGELRSRAESLADSQLGFFSDPFSAENIYTVGKTAFCYGN… |
| A0A3M7SW19 | 81-174 | ISPLTDIAEFIDDKLWLLGNRTLLSLNLSRNELTEKSVNSFLMALSYQKTFMEIHKSQGTGLLRLMMTNNDFSSDYENYIKLTELMK… |
| A0A670YMK6 | 155-261 | None |
| A0A5K3EZB6 | 54-170 | None |
| A0A2G9S3F4 | 40-137 | None |
| A0A6I9YZJ6 | 343-470 | None |
| L5JW53 | 319-438 | None |
| A0A6P8HJG7 | 158-294 | None |
| A0A5K4EQD9 | 80-186 | None |
| A0A1I8H7H5 | 155-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.