DPCstruct | MC23942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 238 ± 31 aa |
| Standard deviation of domain lengths | 31.17 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0112 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523VD00 | 45-304 | VAWLGAGLVLPCGSLTFYRRAARRKVGLAVLFFALFALLVSTLATAGVAGALLSTSSDVRQAFESGEVPVIVIEDGVARVDADGPIV… |
| A0A523EIZ9 | 12-251 | VFLAPFYAFFARAFYRDVGIHWRGMAYAYLLLLLAVSWIPLSVDVYVQWSGFLADDAPAIIRQIPSITIENGRLYADVDQPYFIRTT… |
| A0A2M7HJX0 | 8-287 | None |
| W4QFL0 | 3-211 | None |
| A0A5D4KZH7 | 23-280 | None |
| A0A2P8EPA6 | 4-262 | None |
| A0A3A8ZJM8 | 124-368 | None |
| A0A1Q3PBY3 | 10-263 | None |
| A0A496KUS0 | 1-214 | None |
| A0A1G3WKF3 | 2-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.