DPCstruct | MC2394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 10.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.81 |
| Pfam Score | 88.89 |
| Assigned Pfam label(s) | CL0351- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A154PMQ6 | 1-80 | MTSYTFSKKSFKPTPPEKGSFPLDHEGLCKVVMLKYMRCLYENKNENTVCRNMAKDYLACRMDNQLMVQEDWSTIGYADQ |
| A0A813C3W5 | 35-127 | MKLAVSMGKRIMPGRPPDKGSFPLDHFSECSKLKEEYLQCLKQHSHDNMSCRYLSKRYLQCRMDKNLMTKEPMERLGFTEEDVSPAP… |
| A0A2V0PJZ0 | 1-96 | None |
| A0A4D6MKE1 | 1-91 | None |
| A0A3P6RPG8 | 56-135 | None |
| A0A094HWH7 | 370-484 | None |
| A0A834QTI3 | 25-123 | None |
| A0A811M1N4 | 129-222 | None |
| A0A811MQB0 | 297-394 | None |
| A0A2H6KC14 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.