DPCstruct | MC23939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 164 ± 21 aa |
| Standard deviation of domain lengths | 21.11 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4WGY2 | 2-138 | KIALKNIKTELSKQVAFLEKKGKLLEARCLTQRTNYDLEMMQETGVCSGIENYSSHLEFRKQGVPPFTLLDYLKKIDKRFLTIIDET… |
| E1MAG0 | 1-155 | MEVAIAKIEAELEEQLAIFEKEGKLLEAQRLKQRTEYDIEMLREMGYTNGVENYSRHMDGRSEGEPPYTLLDFFPDDFLIMIDESHM… |
| A0A142YN54 | 255-433 | None |
| D4J0C0 | 233-371 | None |
| A0A7X6Z4A3 | 34-187 | None |
| A0A7T8XVD6 | 371-550 | None |
| A0A7S2S9Y7 | 67-205 | None |
| A0A090MU98 | 433-614 | None |
| A0A1W1DE25 | 208-383 | None |
| A0A2X5PBE3 | 182-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.