DPCstruct | MC23938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Standard deviation of domain lengths | 9.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A345ZK07 | 1-109 | MPAVAHLLADDERIVGGVAQRDDDYALVLGGRVVASTDSAGMAIAMLRHARVTLSTDDTPLTVRIAPALENPATREAETAGLTLEAY… |
| A0A352QTF0 | 1-111 | MAIPADKLGEPHAQLRDAQGKLLGGIVFKDGQWVLGLDGRIVGESHSAAHVLAILKRAAALARSEGREATLVFSATLRAAAHQEAAA… |
| A0A855JD03 | 60-154 | None |
| A0A3C0HGY3 | 33-139 | None |
| A0A7W3FP76 | 32-137 | None |
| A0A091BAE8 | 46-165 | None |
| A0A7U4N822 | 20-142 | None |
| A0A839ZIH8 | 42-136 | None |
| A0A2S7D4T1 | 2-99 | None |
| A0A4Z1R2X5 | 17-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.