DPCstruct | MC23935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 358 ± 35 aa |
| Standard deviation of domain lengths | 34.94 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 30.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2M3A9 | 5-350 | RQRYEAAITARNCTGLMLIDRSDELSVLFERCHALEARLKAGAVAMGQRECEVQALKLQVSELERSVAATRKCLPDVDGVDEEVAAL… |
| A0A086L3P1 | 68-359 | EQSRLIQKVKEESQLMEEYVVEIDRLNNVINVLEKEMLNTKRVYQTAIESRNLTGIQLIDRQAQDKDTEKKSQRALHEKEQDVNTLR… |
| A0A3P9MKB0 | 60-409 | None |
| A0A671L3Q1 | 2-358 | None |
| A0A2A9MD66 | 5-299 | None |
| A0A7S1GTR0 | 100-462 | None |
| A0A7J6UDY6 | 177-581 | None |
| A0A670J3H1 | 510-873 | None |
| A0A6I8NZ88 | 541-922 | None |
| H0V6M0 | 1-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.