DPCstruct | MC23933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 250 ± 36 aa |
| Standard deviation of domain lengths | 36.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14738 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2M2S7 | 1-300 | MASNRPHDVLYDSTYTVSGARDFYKQQAHFQVEKVPEYGNFFSELPHYPAASVRVKGGDQVPMFVNRGFHQHTSTHQQRVSQSSGAQ… |
| A0A816EQS2 | 1-176 | MELIFQENAKKYIQSKLITNKKTTNYMHYIGSQTDYREESTQTDPFSPTYTISGGEHPEVFALSDFTYGKGLPVTSVEISFIERLRA… |
| A0A7M7NC68 | 12-308 | None |
| A0A226ERH5 | 102-324 | None |
| A0A6V2C272 | 19-238 | None |
| A0A1W0A1M5 | 484-693 | None |
| A0A0J7KG30 | 1-260 | None |
| A0A1Y2CYK8 | 1-276 | None |
| A0A4X2LCM3 | 270-489 | None |
| D7EKM5 | 3-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.