DPCstruct | MC23931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 103 ± 13 aa |
| Standard deviation of domain lengths | 12.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04997 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2LZ88 | 2-108 | AICDTCNLKLADCAGHFGYITLELPVFHIGYFKNTLNVLQCICKTCSRLLLPDSEKRKWSRKFRNPRLERVPREQMFRKVNDICKRQ… |
| A0A444SLT5 | 56-174 | DSRMGVSQSVKVCGTCSETIKNCVGHFGYMDLPQPVFHVGYFKNIVHLLQNICKICSHVLLKPSDKKMLLSTYKKTTSYLKKKAQYK… |
| A0A482SUG9 | 21-111 | None |
| H8WH25 | 2-100 | None |
| A0A383VPV1 | 89-199 | None |
| F6HAH5 | 27-126 | None |
| A0A0A9MYH9 | 46-134 | None |
| A0A834SQQ6 | 80-180 | None |
| A0A5J4VK66 | 55-158 | None |
| A0A165IJY3 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.