DPCstruct | MC23930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 110 ± 13 aa |
| Standard deviation of domain lengths | 12.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 44.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W1VQL0 | 20-114 | EIIEKSYTNVQTPWQKISDITAINQFKILKAFQKHKASDFHLNGSTGYGYGDVGRDLFEEIWASIFKSEAALVRSNIVSGTHAIAIS… |
| A0A0D2LSZ1 | 149-260 | PASAPAQAPIISAEDLVWRCAAELAPDFATIDRRVARNLRRSQEAFRRQRVGPHHFQGSTGYGHGDMGREALDAVFAEIMGAEAALV… |
| W4V3J8 | 15-124 | None |
| A0A830I1T7 | 1-109 | None |
| A0A5N9VWT3 | 1-93 | None |
| A0A453DAM7 | 14-130 | None |
| E0CSR3 | 24-136 | None |
| A0A6B0Q4U3 | 1-105 | None |
| A0A3L6Q3D3 | 2-146 | None |
| A0A3M7KQD7 | 320-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.