DPCstruct | MC23924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 176 ± 9 aa |
| Standard deviation of domain lengths | 9.40 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 41.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2LHQ5 | 1-201 | MHSTQGFHHYPQLIADRPSCGNPVLTPFDQALCLVNSAFDLDPLRLDGAVLHQLVEAVASVLEGCPGLAADVWDDTLLLTAPLRALL… |
| A0A7J7UQ97 | 221-400 | VFQYLTRLLRSLSSGGNDCTTSTACMCVYGLLSFVLTSLELHTLGNQQDIIDTACEVLADPSLPELFWGTEPTSGLGIILDSVCGMF… |
| A0A498IW40 | 340-515 | None |
| A0A317Y3S0 | 390-561 | None |
| A0A834XC07 | 4-173 | None |
| A0A834WUL3 | 55-218 | None |
| A0A0E0M5K5 | 137-315 | None |
| A0A177WS89 | 412-590 | None |
| A0A1D6KC41 | 94-263 | None |
| A0A1D6KC18 | 234-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.