DPCstruct | MC23923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 147 ± 30 aa |
| Standard deviation of domain lengths | 30.33 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 70.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.88 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF18951- PF00504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2LFM5 | 6-139 | LASVDFGDAQLEASAARSDEPTPSIKPGLARLLTPRNMSLVNGRLAMMGFSAGVVGELLHGQPLGAQLLAAAPQALAASLLLAAATA… |
| A0A0D2LKG0 | 1-120 | MELDAARPPQMRSLSSLLTPHYILLVNGRLAMMSMVGGVGGELLLRKPFAALLLLAPPAVLGLMVLLSVASIIPFMLGEEEGDEVFG… |
| A0A830HF44 | 74-221 | None |
| K8EP53 | 86-217 | None |
| K8FED5 | 17-233 | None |
| A0A5B8MX61 | 317-418 | None |
| C1E8A2 | 34-170 | None |
| A0A383WAQ4 | 2-211 | None |
| A0A830I470 | 205-337 | None |
| I0Z0E0 | 30-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.