DPCstruct | MC23921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Standard deviation of domain lengths | 9.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2MB59 | 7-122 | EDGEKWLAAGIAGLQQNAFYMHRALDSNNLRDALKYSAQMLSELRTSKLSPHKYYELYMRAFDELRKLELFFKEETRRGCSIVELYE… |
| A0A0D2L5I2 | 2-111 | EEQDKFLKEASTSVKKNAYFMSKAMDEDNLREALRYSAAMLGELRTSYLSPQKYYELYMQVFDQLAHLESFFADEHAKGRTYSELYE… |
| A0A6P5VT95 | 7-131 | None |
| A0A0R3T432 | 5-130 | None |
| A0A3R6Z982 | 384-496 | None |
| A0A6H5H135 | 6-115 | None |
| A0A2I0KI66 | 6-103 | None |
| A0A7J8CMZ3 | 3-119 | None |
| B4I816 | 17-143 | None |
| A0A1Y3ET03 | 10-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.