DPCstruct | MC2392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 131 ± 13 aa |
| Standard deviation of domain lengths | 13.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812WXV0 | 315-446 | YCHEKSSTLRIESLTPEADIAEAEPKEECVRMYHHPSGLVKPVPVTQLQKNRTAYRHRGWCAAEREWSSTRTATNLSREVDALEGEK… |
| A0A812N295 | 37-154 | WVERIADLTPEIDRQQPPSVIDIYCKDTSKFEARPFSELVLNNTPYFQRGCCVAEVQWASTKVHLSHFAPMSPATFQERVRQGEVGS… |
| A0A812XNG7 | 80-213 | None |
| A0A812WBJ4 | 176-305 | None |
| A0A812VEY4 | 594-705 | None |
| A0A812J248 | 166-296 | None |
| A0A812MR84 | 305-421 | None |
| A0A812UK72 | 2-123 | None |
| A0A812U7A9 | 178-307 | None |
| A0A812WIZ1 | 172-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.