DPCstruct | MC23919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 135 ± 18 aa |
| Standard deviation of domain lengths | 18.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.42 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0369- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P0XUK2 | 133-229 | AHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFTDKYVKLTPTTVSQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIS… |
| A0A0D2KTE7 | 20-161 | EIWLVGNEQSAAAAPPDMALLPAGDLAKSYAHWVDRATIAWRVPPTEGAGGPERQFHLHFSPDASLRVTAGGVEGAETTLPLRVAGS… |
| A0A259LKD2 | 157-299 | None |
| A0A1Y5H5R9 | 5-117 | None |
| A0A438DU91 | 51-197 | None |
| A0A6P6G0E7 | 1-114 | None |
| A0A2G3AZH7 | 34-196 | None |
| A0A7M1R2V5 | 177-316 | None |
| A0A4S4EG28 | 1-148 | None |
| A0A2P5WME2 | 61-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.