DPCstruct | MC23915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 203 ± 36 aa |
| Standard deviation of domain lengths | 36.20 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00839 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1MM12 | 332-556 | MCEDDRANLCAAVAWGGGRVEQCLKDKRAALSPRCKRELFRREVEESEDVRFDGFLARACAVDRDAFCSSIPPGEARVVACLANHLD… |
| A0A0D2K9J1 | 14-200 | SEGCRSEIDGMIERRVRDFKLDSRLRTACENDIYDTCAYLGDVDSVGSYESTVINCLQDYSSEIKGDECRAQVKKYLKLAASDIRFD… |
| A0A3P7LTW3 | 22-215 | None |
| A0A0R3QP18 | 55-302 | None |
| A0A7M3RNS8 | 124-396 | None |
| A0A0D2N415 | 639-871 | None |
| A0A6I9PQQ3 | 8-134 | None |
| A0A1F9ZTV4 | 38-251 | None |
| A0A815QWY0 | 10-177 | None |
| A0A2V0PQF5 | 462-689 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.