DPCstruct | MC23912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 152 ± 30 aa |
| Standard deviation of domain lengths | 30.20 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3X3T8 | 4-88 | VQPPRGFGDNPVAIYHDPDLPPSHHYLAAYRWLETGFGAHAVVHLGKHGNLEWLPGKTLGMSAACGSDAALGNLPLIYPFLVNDP |
| A0A0D2K6U8 | 300-417 | ALEENWGKPPGNLNSAGNDLLIYGKQFGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGFAAYYTYLEKIFKADAVLHFGTHGSLEFM… |
| A0A0Q3NW02 | 320-497 | None |
| A0A396QH24 | 37-236 | None |
| A0A7G9ZA00 | 2-150 | None |
| A0A212DTQ8 | 3-117 | None |
| H8GWP8 | 560-754 | None |
| A0A1U7PZB8 | 129-280 | None |
| A0A812Z558 | 2-160 | None |
| A0A7W7A4Z3 | 228-414 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.