DPCstruct | MC23911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 87 ± 2 aa |
| Standard deviation of domain lengths | 1.96 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 88.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V0PHK2 | 292-379 | LPLPYPSQLPAALDATDLAPRRTVRLGRHVVARCALLAATTARQLSALAALARAQVVAVVPLPQGELVVVPYFDGRAHVRVVAFLRLQ |
| A0A0D2K595 | 1-83 | MPSALYATELAHRRSVPLGRHAVCRCALAPAASPRQLAALSAMARAQLVAVAPLQGCELVVVPYFDSRGAVRVVAFLRMQSGE |
| A0A061R8Q5 | 1-88 | None |
| I0YX90 | 440-526 | None |
| A0A0D2KYW9 | 217-303 | None |
| A0A7R9YSM9 | 334-420 | None |
| D8UJA0 | 745-834 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.