DPCstruct | MC2391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06803 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3NR04 | 67-178 | LTVPDPDRVERDERLVRRRFWRTLRANLHRIPFLEDLLAAYFCATDPATPYRAKAILLGALAYFVLPVDVVPDWLLGIGFTDDAAVL… |
| A0A559JGR2 | 4-118 | ESKYEKHYSDEGFWKKLKKVAIGAGLKVVYSGLTLYYALESPKTDAKAKAIIYGALGYLIFPIDAIPDAIPVIGYADDLGVLLFAAG… |
| A0A810DS97 | 62-177 | None |
| A0A059G749 | 23-124 | None |
| A0A5J4JIF9 | 2-97 | None |
| A0A7V3AG26 | 8-115 | None |
| A0A3D1QC02 | 13-120 | None |
| A0A2M9YZN8 | 5-102 | None |
| A0A2T1BXR8 | 205-308 | None |
| A0A1G7AS95 | 5-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.