DPCstruct | MC23907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 322 |
|---|---|
| Mean domain length (aa) | 140 ± 23 aa |
| Standard deviation of domain lengths | 22.52 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.07 |
| Pfam Score | 95.86 |
| Assigned Pfam label(s) | PF01584- CL0025- CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7S2M6 | 5-103 | AEPALELISFCIGEQEFCIDVKTVREIRGWTPATPIPHAPGYLKGVINLRGAIMPVIDLRNRLGLGVTIPETRHVIVVVECQDRLAG… |
| A0A6M4IJS0 | 2-118 | LVVASDRDAFGIPVEQVREVIRSAALRRVPGSPPVLRGIVNVRGGIVTVLDLQALLSGERAVTAGSVVLLEYGSRLIGLAVHAVHDV… |
| A0A1G3MYG8 | 136-282 | None |
| A0A1P8WKK1 | 1-100 | None |
| A0A2A2FKE9 | 22-166 | None |
| A0A655UCU2 | 91-225 | None |
| A0A3M0Y9K4 | 709-851 | None |
| A0A832A2Q4 | 76-228 | None |
| A0A6J6RAV8 | 69-208 | None |
| A0A1F3Y257 | 559-690 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.