DPCstruct | MC23902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 160 ± 31 aa |
| Standard deviation of domain lengths | 30.84 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.13 |
| Pfam Score | 37.09 |
| Assigned Pfam label(s) | PF10946- PF08906- CL0250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V0QZW2 | 100-279 | YQLLPSSAESSRVLTRLQVTTRSTLGTIAYHTGGLLIDHGWLRVLGSGHPLLPRNLADWNEGRADGCLLVADDVVGGFFAINGGGLG… |
| A0A7M3FU80 | 10-156 | EIINLWSNYGFGTFMQGYFKSVNPEEFKEILEESSQRYKDSIVLFATGMGDLVIWSDGYVRLLNYRYGIVKTIMFTFEFFFQNITDL… |
| A0A2M9L4F7 | 21-236 | None |
| S3Y4A2 | 47-221 | None |
| A0A3E2YF61 | 1-126 | None |
| A0A0M8W100 | 12-216 | None |
| A0A519NEU1 | 26-189 | None |
| A0A3M2C6K3 | 233-375 | None |
| A0A525WMH1 | 78-229 | None |
| A0A7X6KF42 | 13-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.