DPCstruct | MC2390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 9.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3YDV5 | 26-128 | KKSPVFAAGLSFLFNGLGQAYNGQFIRGVMVLLGSFFGLFLLIVPGVAIWAWGIYDAWATARQMNEGLIPYQETSPLMIVGFVVVWA… |
| Q0W8Q2 | 9-116 | IKNPLIAAVLSFIVPGWGQVYNGQGYLKGLMFMIGELIGLLFFIVPGLIVWVYGIYSAYKVADNINKGLMPAGKEVTIVNHVIYLAI… |
| A0A1G8WZG1 | 3-96 | None |
| A7I777 | 37-157 | None |
| A0A2D3C3C7 | 32-126 | None |
| A0A0Q0ZN75 | 69-185 | None |
| A0A1V4ZJ74 | 3-127 | None |
| A0A1G9A1P0 | 1-107 | None |
| A0A831KYP6 | 122-235 | None |
| H1YWI1 | 48-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.