DPCstruct | MC239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Standard deviation of domain lengths | 8.59 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T2UNY8 | 20-131 | IHMNFDNTVSLYHVVEAEDDFETAAHDIFDLLVESQNEFPDWPRVLYLDIENHARDDGRLEEDMIEFQQEFLIAAMGKFLTALALPL… |
| A0A2V9ICK0 | 2-97 | VYSHEGFDESAQTLFKLVQKAQEIRPGSKRKLFLDIEGHRTSDGSFDAAMLELQMEFLVGFLARFLSEIHCPLMSVTNPKPQENEIP… |
| A0A3D3JPK8 | 11-120 | None |
| A0A358Q424 | 3-105 | None |
| A0A7J2RH35 | 6-113 | None |
| A0A2E9QH05 | 56-162 | None |
| A0A229NWZ8 | 2-81 | None |
| R6RHX6 | 108-213 | None |
| A0AHM8 | 4-110 | None |
| A0A7W8EW60 | 5-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.