DPCstruct | MC23899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 51 ± 2 aa |
| Standard deviation of domain lengths | 2.43 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 87.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2VWB4 | 71-123 | NYLLTTAENELGVVVAHSEAGVQMVPISWCEMQCPRTHAKEFRKVARVQPEYL |
| G7PDP1 | 278-326 | TTAENELGVVVAHSESGIQMVPISWCEMQCPKTHTKEFRKVARVQPEFL |
| A0A4W2EFG3 | 198-246 | None |
| A0A671EXV9 | 120-168 | None |
| A0A5F9DGN3 | 98-152 | None |
| A0A3M7P1M2 | 161-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.