DPCstruct | MC23898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 154 ± 11 aa |
| Standard deviation of domain lengths | 10.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.95 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0031- PF00566- PF19430 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194R0C2 | 242-383 | NAELIELESALLDGCSPQEINVITKGKKIPDSLRPDVWLVCLNCQDGVNQLLLFDEIFDLPNQNELRDDVKKFVQRLDNEDEEKLAV… |
| A0A814RMJ0 | 1-157 | MSDSDEEFNDESLWETELEIALLSNCDYGAIRNISKLRPLPDSLRSKVWKVCLDVQQDIENNQISKWKEIYDLPQQDKIREDCRHLA… |
| A0A5K3FQV9 | 2-166 | None |
| A0A7M7NBA6 | 1-151 | None |
| A0A7R8WZN5 | 3-142 | None |
| A0A182F673 | 286-462 | None |
| F7B3A6 | 370-521 | None |
| A0A1J1IPH2 | 3-144 | None |
| A0A7R9H0R9 | 1-152 | None |
| A0A091DV55 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.