DPCstruct | MC23897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 322 ± 17 aa |
| Standard deviation of domain lengths | 17.10 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 29.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7Q6Z9 | 201-507 | DTIIKNNHLSFYQMSHDLDSRIEQVNLKVYQSILNRNILDANIFGRMEKLSIYGKLMSIDKNTFKNLSKIKFINFFIDNIDMFLFES… |
| A0A814PNH1 | 1-358 | MNPYVFKNISYLRIYGEINSFQKDLLIYFKHLKSVRFDGQNFRKFMHKIGIDWISYLNINKTINPLKMRKVYSNYESIVNISIAFNN… |
| A0A3M7QSL5 | 160-461 | None |
| A0A3M7QYJ6 | 61-375 | None |
| A0A3M7RFA3 | 1-330 | None |
| A0A813MB82 | 205-524 | None |
| A0A3M7S521 | 1-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.