DPCstruct | MC23893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 71 ± 3 aa |
| Standard deviation of domain lengths | 2.81 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 94.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 54.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P1BH01 | 55-119 | VAKFVCLVKTHIDIVSDFDQDLIDQLVGLSKAEDFLIFEDRKFADIGNTVSLQYGAGVHKIASWA |
| A0A1B0GBC6 | 1-63 | MCLLKTHVDVLEDFNNEFIETLLAIAERHKFLIMEDRKFADIGNTVSLQCGKGLYEIARWADV |
| A0A0L0SB12 | 56-125 | None |
| A0A0D2XV97 | 51-126 | None |
| A0A287MLZ7 | 134-204 | None |
| A0A1J1IHM2 | 839-909 | None |
| E5A7A6 | 267-337 | None |
| E2C625 | 531-601 | None |
| A0A0G1I3Z3 | 43-114 | None |
| A0A0W4ZS14 | 8-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.