DPCstruct | MC23892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 55 ± 3 aa |
| Standard deviation of domain lengths | 3.43 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 68.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484BJX3 | 1-61 | MDSTSGPGAFDDEPPPEPRDGWLLVRIHVPELNVYKCLQFPSERLVWDVKQQVLASLPKIN |
| A0A1B0G6J2 | 1-58 | MDSGSGPGFDDEPPPEPRDGWLLVRIHVPELNVYKCLQFPSDKLVWDVKQQVLASLPK |
| A0A151WPY0 | 64-117 | None |
| A0A1B0AUY1 | 1-62 | None |
| A0A5B7J1R9 | 14-67 | None |
| A0A6J3BUP9 | 1-50 | None |
| A0A182FM16 | 1-57 | None |
| A0A194PDL9 | 1-50 | None |
| E9IL52 | 3-53 | None |
| A1Z9K8 | 1-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.