DPCstruct | MC23891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 3.16 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 52.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0603 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2LRH6 | 89-145 | LKTRESEEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTP |
| A0A1B0G4Y2 | 1-60 | MKSRLSAEDKRKKVKGILMLMQPCDHIIEIAFPLRRDSGDYEMITGYRAQHSTHRIPTKG |
| A0A3S0ZEC7 | 158-217 | None |
| A0A814HH07 | 441-497 | None |
| L8HPX7 | 25-75 | None |
| A0A6A4WQF3 | 74-126 | None |
| A0A674IQY3 | 115-171 | None |
| A0A2C9K2R3 | 20-76 | None |
| A0A183U0Z2 | 77-131 | None |
| A0A7R8HB18 | 253-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.