DPCstruct | MC23887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 133 ± 25 aa |
| Standard deviation of domain lengths | 25.08 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5ZS10 | 146-247 | KFWQTQPVPRFDEGTRKTVSEGPLREQRVEDVSTEAQPLVDGFEWVTMDLEDDGEMKEVYQLLNGHYVEDDEAMFRFNYSPSILRWQ… |
| A0A815TPB2 | 28-137 | EKSASKQEWKFWQTQPVPTIGTKIDTTNIGPIESNKSVDEIRQEPYELPNGFFWDDIDIHVDEQLQELCTFLDEHYIEDDGNNFRLK… |
| A0A438EWM4 | 2-112 | None |
| A0A6V7UI18 | 5-102 | None |
| A0A1R1XFU3 | 15-164 | None |
| A0A673JYR1 | 57-214 | None |
| L8GYB0 | 288-432 | None |
| A0A421J377 | 1-123 | None |
| A0A6V7Y3V2 | 1-112 | None |
| A0A7I2V3U5 | 61-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.