DPCstruct | MC23886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 178 ± 28 aa |
| Standard deviation of domain lengths | 28.46 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 44.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5Z4C3 | 1-143 | MTTVLSRDIDTKDSPSDSGKSLSSSIPPLGVPLQKRPWFRSSSVIDKHAIATQPSVFDDATTADKYQPPADWENTHRFDPLFRWTWS… |
| A0A5Q4BES2 | 1-162 | MALNLDGVQTSKSISTNGSGVQNSNEKVVRISGSETTQKIRHRILEERARENVAEKPYTNISSLWRRQTTSHKPDEIATQPSVFDDP… |
| H0EQI1 | 27-245 | None |
| A0A1Q5UDH1 | 1-212 | None |
| A0A1B8E184 | 1-193 | None |
| A0A5N7AWS3 | 14-158 | None |
| A0A7C8U205 | 1-193 | None |
| A0A0N0DE00 | 14-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.