DPCstruct | MC2388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 99 ± 7 aa |
| Standard deviation of domain lengths | 7.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0TF67 | 45-139 | YNAIAFNDGYHTSHHLHPRRHWADHPANLVTHAREYGKQGTIVFRGIDFHETWWLLMTKNYDRLAKCYVHMDLDTPRPAQHEIVALL… |
| A0A7C4Y0C8 | 1-95 | YNRTCWNDGYHIIHHLRPGMHYTEMPGEFLKRKDEFAAKKAIVFDGIHYLHVFMWLLTKRYDKLAANLVNINGNMFESEDQAIQLMK… |
| A0A1V6TWT0 | 75-175 | None |
| A0A2H4S8A2 | 730-832 | None |
| A0A1Q9CGC1 | 100-203 | None |
| A0A7S2Z264 | 44-141 | None |
| A0A383V8J9 | 371-458 | None |
| A0A841J4K6 | 30-123 | None |
| H1VSY8 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.