DPCstruct | MC23877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 197 ± 39 aa |
| Standard deviation of domain lengths | 38.65 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X6NPQ0 | 342-528 | QTELNIDEDTAHDWLMANVAVPPRRDGAPATLTRALLVLLRAKSHWVQALKKRILLVYFRAIEVDARVLHAADAVQWVADLKYFTSV… |
| A0A1X6NY47 | 5-190 | KVKAEAWLNQFIRRASWRNASISVNVRVSMLVLRVKPHLHQAWNDLIVNTYFEALGLQVKNLNEATAKQLIDGSAYYVSVRGREACL… |
| A0A1X6PC54 | 419-682 | None |
| A0A1X6PK09 | 1-141 | None |
| A0A1X6PJG4 | 77-280 | None |
| A0A1X6PEC4 | 202-391 | None |
| A0A1X6PCY0 | 194-371 | None |
| A0A1X6PC63 | 590-785 | None |
| A0A1X6PKV2 | 5-222 | None |
| A0A1X6PBL2 | 22-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.