DPCstruct | MC23876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 172 |
|---|---|
| Mean domain length (aa) | 187 ± 38 aa |
| Standard deviation of domain lengths | 37.85 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.37 |
| Pfam Score | 87.69 |
| Assigned Pfam label(s) | PF02777- CL0091- PF04176- PF00081 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L8G7R7 | 3-171 | LHHSKHHATYVNNLNITEEKYAEALAKGDVTSQVSLQAALKFNGGGHINHTIFWTNLSPNGGGEPQGELLDAIKRDFGSFEKFKEKF… |
| A0A1X6NW43 | 3-195 | LHHDKHFAAYTKKLNAALAAAGLADVVTTEGALRKLLANVGSAGGRGGSAIADPALRAAIRNNGGGVHVNHQLFFRSMTAPGTSPAP… |
| A0A1B0C4W6 | 501-699 | None |
| A0A4V6DI69 | 332-588 | None |
| K1UPC9 | 5-157 | None |
| B0JVI0 | 1-143 | None |
| A0A7W6EXZ5 | 22-143 | None |
| A0A258EJC6 | 10-171 | None |
| K8ERS3 | 197-398 | None |
| A0A1Q9C7Y4 | 802-1022 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.