DPCstruct | MC23875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 118 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X6PL39 | 124-227 | RMKCSICHYEAREDGVSGHTARQCPLNNKECRHTLSEDNPFYKPGQCINPGCGHVRQCNVCHMVGHTAAALRLTTCRWRLTSDRRIV… |
| A0A1X6NV08 | 3-103 | PRCGYCGSDDGPQGVHSFRVCRKRDFVCRYTLPDDNVFSLRGVCRNPEHSDIKCSACHEDGHSFNSQVPRIGRWQFGASGELRPAIR… |
| A0A1X6PKF7 | 1-122 | None |
| A0A1X6PHU0 | 234-357 | None |
| A0A1X6PGZ3 | 1-122 | None |
| A0A1X6PCC9 | 1-126 | None |
| A0A1X6PD75 | 1-122 | None |
| A0A1X6P9U6 | 83-186 | None |
| A0A1X6P771 | 58-180 | None |
| A0A1X6NWW2 | 2-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.