DPCstruct | MC23874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 139 ± 14 aa |
| Standard deviation of domain lengths | 14.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8U2G1 | 461-584 | QYIGTTSDLRNALRTALGRRPEKTFYFKAATLPTSEPTALQAIRDAWFSECGGQPNGNRLAIERSMWQQPVDAGAISERGRKGAAEE… |
| A0A1X6NUL2 | 1-138 | MHLGRRPSACHAYRLLALPRPSRTAFDDILGAWAGELGGPPPGNDGGDEQARWEKPVDVRWAGSGVVLSAAELEALDECALDAETAK… |
| A0A388KW50 | 231-388 | None |
| A0A7R9XYT3 | 52-178 | None |
| T2JT55 | 2-117 | None |
| D8SPE5 | 206-331 | None |
| A0A6U0ITV5 | 110-257 | None |
| D8SYR2 | 314-444 | None |
| K8YTT3 | 132-284 | None |
| A0A0G4GGJ4 | 85-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.