DPCstruct | MC23873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 149 ± 16 aa |
| Standard deviation of domain lengths | 15.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X6NN73 | 1-127 | MKIDIEGRDTACLDSLHTIPRTSRPTYVSVENVNEAHIALLAELGYTSQKAVDQQIIHARYMGQPDLLGNSGPFGDAAVHLSGGTEW… |
| A0A1X6NK12 | 12-146 | TTCDALIRDYGTPFMLKVDIEGQDTHCIASLKRLRRSERPPYASVENVTPDHIRLFTGLGYHRFKAVDQGVLHTEAAKNAPELLGHS… |
| A0A2L2BSM0 | 99-235 | None |
| A0A2V9TUB3 | 1-165 | None |
| A0A7J6PM01 | 316-457 | None |
| A0A2N2ABJ5 | 496-643 | None |
| A0A5P1UX23 | 235-380 | None |
| A3X7M7 | 1-145 | None |
| A0A812N034 | 140-312 | None |
| A0A812N7C2 | 440-590 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.