DPCstruct | MC2387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 138 ± 22 aa |
| Standard deviation of domain lengths | 21.95 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0508 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5G6S5 | 76-207 | SLDKIYKRVLKKTNINRYALKKALSFYKKNRFKKGLSSKYIAIADYTKTARQKRLYIISLKNGAVYRHKIAHGKYSGALGGKVRKSS… |
| A0A7C4U993 | 35-146 | PKEKKSYRVNPAWLAKLEEKVSQAKTFTKQKGYNNNYCFLIDMSLASGQNRFFIYNLKKDSLESSGLVAHGNCFEYWLEGRRYSNKV… |
| A0A0C2UYT9 | 1-170 | None |
| A0A1W9JP37 | 268-399 | None |
| A0A370XCJ4 | 4-136 | None |
| A0A849HYP3 | 107-237 | None |
| A0A0P0M1F9 | 27-163 | None |
| A0A1G0G9S8 | 37-165 | None |
| A0A3G6PIX6 | 503-632 | None |
| Q7P690 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.