DPCstruct | MC23867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 123 ± 9 aa |
| Standard deviation of domain lengths | 8.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3SN31 | 1-126 | MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTFAFGLTLTWLYFWWEVHNDYDEFNWYLYNRMGYWSDWS… |
| A0A672LLK2 | 1-108 | MARQRLLQRYEHQPFVSCLAGLYGCQWRRYQITHPDIYLECGSFALIVLTFCLSLVFLYFWSEAQNDYNDFDWFNFGNLGFWFPWSI… |
| A0A3P8XL21 | 18-150 | None |
| A0A6I8QH15 | 1-125 | None |
| A0A3B3XT24 | 1-127 | None |
| G3IDD5 | 1-125 | None |
| A0A4Z2IIY0 | 14-147 | None |
| A0A6J1VTP6 | 24-136 | None |
| A0A6J3ARS1 | 21-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.