DPCstruct | MC23866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 107 ± 18 aa |
| Standard deviation of domain lengths | 18.21 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 67.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672L985 | 1-96 | MPLGLRKKKNKSKESSNLVENEEVSGHAGVGKSAVNGGGLPAPPANMRPKLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEAFNLHP… |
| A0A6P6EL45 | 3-113 | SAAAREPRGADAPRAPAPPPSPAEPPAAPRARPRLVFRTQLAHGSPTGKIEGFTNVRELYAKIAEAFGIAPTEILFCTLNSHKVDMQ… |
| A0A183RA99 | 1-71 | None |
| A0A182FD96 | 20-114 | None |
| A0A654H0R0 | 1-132 | None |
| A0A183HHN8 | 1-114 | None |
| A0A151NBE4 | 345-480 | None |
| A0A553RCP9 | 1-99 | None |
| A0A4Z2BXB6 | 1-101 | None |
| H2LRQ4 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.