DPCstruct | MC23865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 184 ± 21 aa |
| Standard deviation of domain lengths | 20.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.01 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF09175- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5MPP9 | 1-160 | MSPFVTAMAEAVRSDGRSQGYEATAYLSPTTPKNKMQLLVSEINEESKWKMCVDAGVEKSHEKTMMVLSWGEDCENYKIATKAEVLD… |
| A0A672L6Z3 | 1-173 | ARVVRVDRKLLGYQLTAYLDMPTSRVQIIVVSIAVKNNWKMCADGVFLSKHNVGARIAWGAECQQYAITINAETGHQGPSPMAYLKV… |
| G3P5I3 | 404-590 | None |
| A0A7J6AL92 | 796-966 | None |
| A0A3L8SPT1 | 475-694 | None |
| A0A3B4AFI9 | 305-461 | None |
| A0A2D0QJ58 | 1-200 | None |
| A0A6I9XBE0 | 31-232 | None |
| A0A3Q3K689 | 126-321 | None |
| A0A665WIB2 | 26-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.