DPCstruct | MC23864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 123 ± 13 aa |
| Standard deviation of domain lengths | 13.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 45.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q1CFR0 | 27-123 | LKLPHIFLSVLDSLEPLDCVRASELCNQNNQCSSRYRIMRQCLSGGDKERSAMLASRECQGALEVLQDSPLYDCRCKRNMKKELQCL… |
| A0A672L348 | 14-122 | ASHFALSGLGTHGWRAPMDCLRASEVCNQNSQCSSRFRIMRQCLVGRDRTTMLGNRECQAALEVLQDSPLYDCRCKRGMKRELQCLQ… |
| A0A6P8FU41 | 13-146 | None |
| A0A0F8ATB1 | 117-224 | None |
| A0A4W2BWV6 | 107-225 | None |
| A0A3B4T662 | 15-141 | None |
| S7N9I3 | 8-122 | None |
| A0A7J5YQP4 | 30-165 | None |
| A0A5C6MXX7 | 19-140 | None |
| A0A556TJ42 | 37-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.