DPCstruct | MC23861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 199 ± 51 aa |
| Standard deviation of domain lengths | 50.75 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 82.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 26.87 |
| Pfam Score | 81.82 |
| Assigned Pfam label(s) | CL0056- PF01391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7P696 | 9-189 | YTRWGNDVCPEDAELIYSGSIGGAHYIHTGSGSNHLCMPDEPIYDEVQAGLHDHRALLYSSEYEVHSAPLRIQPMHDHTPTCAVCRA… |
| A0A2V4CW56 | 93-277 | KANNAGNIFIRWGRTTCPMNTELIYDGLVAGGHYQHSGGGSNTLCLSKNPTWLNYDDGSQNGNLLYGTEYQTNPSFGLEVFNSLYDF… |
| A0A6S7FUT1 | 675-865 | None |
| F1QYN1 | 1433-1714 | None |
| A0A6S7I200 | 21-162 | None |
| A0A6S7HJW2 | 429-616 | None |
| A0A7M7NBX7 | 2-162 | None |
| A0A1W9X0E0 | 153-285 | None |
| A0A6P8I6S6 | 45-227 | None |
| A0A2K5N9A6 | 226-500 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.