DPCstruct | MC23857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 104 ± 16 aa |
| Standard deviation of domain lengths | 15.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2XW66 | 4-105 | HRGVRKVISKYLKPGLLEFKNSLCKKSYLRLVQKYCPSLSLEDLAPHPAGVRAQAVNEDGELIEDFLFCNSARSVNVYNTPSPAATS… |
| A0A3B8KVS2 | 2-88 | GEMWRSFSKRAFVKALSRLLPDIRCEHLEPAPAGVRAQALSTDGTLVDDFLVQSHGRVVNVGNAPSPAATASLNVGRLVVGRLAERF |
| A0A3D2JMX9 | 9-114 | None |
| A0A818F8X8 | 197-297 | None |
| A0A2P6NTB3 | 560-680 | None |
| A0A1R4HQB4 | 92-211 | None |
| C3ZZU7 | 203-321 | None |
| A0A261Y7N4 | 55-145 | None |
| A0A6J7QAA1 | 9-110 | None |
| A0A832FN86 | 198-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.