DPCstruct | MC23856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 93 ± 5 aa |
| Standard deviation of domain lengths | 4.54 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0749 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5C413 | 58-147 | YYNHSTFNDLMITGLVGLRPRADEVLEVNPLVPAGKWDWFCLDKVLYHGKMVTIVWDKTGEKYGKGKGLYLLVDGKEVARRADLGKL… |
| A0A358CUW0 | 1-104 | MGKGFGDVQDYFHSTFPDVLIEDLIGFQGSHGDSFEIHPLLPRKQWKFFYLGDLRYHGHDIDILWKEDWSSTTPGMQSKLFVWVDGK… |
| M3CCV5 | 742-832 | None |
| A0A1G8TPL9 | 61-156 | None |
| A0A7X7IIZ3 | 522-612 | None |
| A0A7V3EN43 | 159-250 | None |
| A0A358XKR7 | 1-86 | None |
| W7N283 | 1-100 | None |
| A0A848A053 | 110-201 | None |
| A0A1G0ZRX3 | 440-530 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.