DPCstruct | MC23854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 158 ± 33 aa |
| Standard deviation of domain lengths | 33.39 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03611 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378BX39 | 1-138 | MQAILSFLTEIFSQPAFLMGLIAFVGLVALRSPGNKLLTGTLKPILGYLMLSAGAGVIVANLNPLGGIIEAGFNIRGVIPNNEAIVS… |
| A0A376I4F1 | 1-171 | MEILYNIFTVFFNQVMTNAPLLLGIVTCLGYILLRKSVSVIIKGTIKTIIGFMLLQAGSGILTSTFKPVVAKMSEVYGINGAISDTY… |
| R7D5U0 | 2-214 | None |
| U2R6F3 | 16-165 | None |
| A0A379AG98 | 3-131 | None |
| A0A0K2JGX1 | 2-131 | None |
| E0RKS0 | 1-138 | None |
| A0A5S9M9N5 | 3-134 | None |
| A0A6N8MSE1 | 2-143 | None |
| A0A2X4V1S1 | 2-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.