DPCstruct | MC23849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 290 |
|---|---|
| Mean domain length (aa) | 205 ± 50 aa |
| Standard deviation of domain lengths | 49.55 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 11.67 |
| Pfam Score | 57.58 |
| Assigned Pfam label(s) | PF07946- PF11354- PF11335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8YHD0 | 19-167 | YGTIHQGGPGVAKNLISGDVPTPDGPRQAYVFDHEQAGRLNSVLVAVQVQGQLPAAVELRLPSAPLPDDAGLDLLEPVGLRYAFVSD… |
| A0A1X0YCW9 | 25-236 | ILGTKNLKREKAVRKEAQAFGYIANDKNNVKKLDDIPDFFLLAPQGKHERFLQIRNIINGYFDNIEFVMFDYMSTYSKGRTNIITAL… |
| A0A7W0QG31 | 211-375 | None |
| A0A7C6WEG2 | 2-345 | None |
| A0A7K3WFL4 | 186-363 | None |
| A0A7C5J612 | 26-216 | None |
| A0A1P8WAE6 | 45-302 | None |
| A0A847PDA8 | 84-332 | None |
| S9SIW4 | 7-201 | None |
| A0A5N9AI22 | 61-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.